RetrogeneDB ID: | retro_rnor_933 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 13:82070366..82070581(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Tmem167a | ||
| Ensembl ID: | ENSRNOG00000016686 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 76.71 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | MSAIFNF-QSLLTVILLLICTCAYVRSLAPSILDRNKTGLLGIFWKCARIGERKSPYVAICCIVMAFSIL |
| MSA.FNF.Q.LL.VILLL.CTCAY..SL..S.LDR.K.GL.GIFWKCA.IGE.KSP.VAICCIVMAFS.L | |
| Retrocopy | MSAVFNF<QNLLNVILLLLCTCAYIPSLPSSFLDRSKSGLSGIFWKCAQIGEHKSP*VAICCIVMAFSVL |
| Parental | FIQ |
| FIQ | |
| Retrocopy | FIQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 23 .15 RPM |
| SRP017611_kidney | 0 .00 RPM | 18 .42 RPM |
| SRP017611_liver | 0 .00 RPM | 22 .19 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Mus musculus | retro_mmus_381 |