RetrogeneDB ID: | retro_mmus_2520 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 4:141356890..141357044(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSMUSG00000084238 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Tmem167 | ||
| Ensembl ID: | ENSMUSG00000012422 | ||
| Aliases: | None | ||
| Description: | transmembrane protein 167 [Source:MGI Symbol;Acc:MGI:1913324] |
| Percent Identity: | 82.69 % |
| Parental protein coverage: | 70.83 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | AYIRSLAPSILDRNKTGLLGI-FWKCARIGERKSPYVAICCIVMAFSILFIQ |
| A.I.SLAPSILDRNKTG.LGI.FWKCARIGERKSPYVA.CC.V.A.SILF.Q | |
| Retrocopy | ACIQSLAPSILDRNKTGQLGI>FWKCARIGERKSPYVAVCCVVVALSILFTQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 42 .96 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 32 .26 RPM |
| SRP007412_heart | 0 .03 RPM | 11 .89 RPM |
| SRP007412_kidney | 0 .00 RPM | 21 .54 RPM |
| SRP007412_liver | 0 .00 RPM | 30 .39 RPM |
| SRP007412_testis | 0 .00 RPM | 8 .46 RPM |