RetrogeneDB ID: | retro_ocun_1788 | ||
Retrocopy location | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | GL018890:479946..480161(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TMEM167A | ||
| Ensembl ID: | ENSOCUG00000009326 | ||
| Aliases: | None | ||
| Description: | transmembrane protein 167A [Source:HGNC Symbol;Acc:28330] |
| Percent Identity: | 84.93 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MSAIFNFQSLLTVILLLICTCAYIRSLAPSVLDRNKTGLLGIFWKCARIGE-RKSPYVAVCCVVMAFSIL |
| MSAIFNFQSLL.VILLL.C.CAYI.SLAPS.LDRNK.GLLGIFWKCA.IGE..KSPY.AVCCVVMAFSIL | |
| Retrocopy | MSAIFNFQSLLIVILLLTCSCAYIQSLAPSLLDRNKIGLLGIFWKCAGIGE<VKSPYAAVCCVVMAFSIL |
| Parental | FMQ |
| F.Q | |
| Retrocopy | FVQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .11 RPM | 16 .56 RPM |
| SRP017611_kidney | 0 .00 RPM | 17 .03 RPM |
| SRP017611_liver | 0 .00 RPM | 8 .02 RPM |