RetrogeneDB ID:

retro_chof_1548

Retrocopy
location
Organism:Sloth (Choloepus hoffmanni)
Coordinates:scaffold_32113:8762..8957(-)
Located in intron of:None
Retrocopy
information
Ensembl ID:None
Aliases:None
Status:NOVEL
Parental gene
information
Parental gene summary:
Parental gene symbol:TMEM167A
Ensembl ID:ENSCHOG00000012009
Aliases:None
Description:transmembrane protein 167A [Source:HGNC Symbol;Acc:28330]


Retrocopy-Parental alignment summary:






>retro_chof_1548
CAGAGTTTGTTGACTGTAATCTTGCTGCTTATATGTACCTGTGCTTATATCCGATCCTTGGCACCCAGCCTCCTGGACAG
AAATAAAACTGGATTGTTGGGCATATTTTGGAAGTGTGCCAGAATTGGTGAACGAAAGAGTCCTTATGTTGCAGTGTGCT
GTATAGTGATGGCCTTCAGTATCCTGTTCATGCAA

ORF - retro_chof_1548 Open Reading Frame is conserved.
Retrocopy - Parental Gene Alignment summary:
Percent Identity: 100. %
Parental protein coverage: 91.55 %
Number of stop codons detected: 0
Number of frameshifts detected 0


Retrocopy - Parental Gene Alignment:

ParentalQSLLTVILLLICTCAYIRSLAPSLLDRNKTGLLGIFWKCARIGERKSPYVAVCCIVMAFSILFMQ
QSLLTVILLLICTCAYIRSLAPSLLDRNKTGLLGIFWKCARIGERKSPYVAVCCIVMAFSILFMQ
RetrocopyQSLLTVILLLICTCAYIRSLAPSLLDRNKTGLLGIFWKCARIGERKSPYVAVCCIVMAFSILFMQ

Legend:
*Stop codon
>Forward frameshift by one nucleotide
<Reverse frameshift by one nucleotide






Choloepus hoffmanni was not studied using RNA-Seq expression data.
Choloepus hoffmanni was not studied using ChIP-Seq data.
Choloepus hoffmanni was not studied using EST data.
Choloepus hoffmanni was not studied using FANTOM5 data.
retro_chof_1548 was not experimentally validated.

Retrocopy orthology:
Choloepus hoffmanni does not belong to any of the species groups (eutheria, teleost or neognath), studied for retrocopy-based homology. For more information about studied groups, please go to help section.

Parental genes homology:
Parental genes homology involve 28 parental genes, and 111 retrocopies.

Species Parental gene accession Retrocopies number
Bos taurus ENSBTAG000000395913 retrocopies
Canis familiaris ENSCAFG000000294361 retrocopy
Choloepus hoffmanni ENSCHOG00000012009 14 retrocopies
Callithrix jacchus ENSCJAG000000112383 retrocopies
Cavia porcellus ENSCPOG000000261862 retrocopies
Dasypus novemcinctus ENSDNOG0000000307321 retrocopies
Dipodomys ordii ENSDORG000000158822 retrocopies
Equus caballus ENSECAG000000268342 retrocopies
Erinaceus europaeus ENSEEUG000000010232 retrocopies
Echinops telfairi ENSETEG0000001649011 retrocopies
Felis catus ENSFCAG000000123754 retrocopies
Homo sapiens ENSG000001746952 retrocopies
Gorilla gorilla ENSGGOG000000241911 retrocopy
Loxodonta africana ENSLAFG000000092061 retrocopy
Myotis lucifugus ENSMLUG000000089243 retrocopies
Monodelphis domestica ENSMODG000000256163 retrocopies
Mus musculus ENSMUSG000000124229 retrocopies
Oryctolagus cuniculus ENSOCUG000000093262 retrocopies
Otolemur garnettii ENSOGAG000000090404 retrocopies
Ochotona princeps ENSOPRG000000045162 retrocopies
Pan troglodytes ENSPTRG000000170531 retrocopy
Rattus norvegicus ENSRNOG000000166863 retrocopies
Sorex araneus ENSSARG000000051203 retrocopies
Sarcophilus harrisii ENSSHAG000000119844 retrocopies
Sus scrofa ENSSSCG000000291732 retrocopies
Tupaia belangeri ENSTBEG000000024323 retrocopies
Tarsius syrichta ENSTSYG000000100181 retrocopy
Tursiops truncatus ENSTTRG000000090332 retrocopies



Copyright © RetrogeneDB 2014-2017