RetrogeneDB ID: | retro_ogar_2189 | ||
Retrocopy location | Organism: | Bushbaby (Otolemur garnettii) | |
| Coordinates: | GL873600.1:3979860..3980109(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL27 | ||
| Ensembl ID: | ENSOGAG00000003940 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L27 [Source:HGNC Symbol;Acc:10328] |
| Percent Identity: | 71.08 % |
| Parental protein coverage: | 61.03 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 0 |
| Parental | VTAAMGKKKIAKRSKIKSFVKVYNYNHLMPTRYSVDIPLDKTVVNKDVFRDPALKRKARREAKVKFEERY |
| .TAAMG..KIA..SKIKSFV.VYNY.HLMPT.YSVD.PLDKTVVN..VFR.P.LK.K...EAKVKF..R. | |
| Retrocopy | MTAAMGENKIATASKIKSFV*VYNYSHLMPTGYSVDVPLDKTVVNQEVFRNPSLKCKVCQEAKVKFKDR* |
| Parental | KTGKNKWFFQKLR |
| K..KNK.FFQKL. | |
| Retrocopy | KISKNK*FFQKLQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |