RetrogeneDB ID: | retro_ecab_132 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 1:69306314..69306533(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL27 | ||
| Ensembl ID: | ENSECAG00000007500 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L27 [Source:HGNC Symbol;Acc:10328] |
| Percent Identity: | 58.67 % |
| Parental protein coverage: | 55.15 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | IAKRSKIKSFVKVYNYNHLMPTRYSVDIPLDKTVVNKDVFRDPALKRKARREAKVKFEERYKTGKNKWFF |
| .AK.SKIKSF.K..N...L.PT...VD..LD.TVVNK..F.D.A.KRKARREAK.K..E..K...NK.F. | |
| Retrocopy | LAKPSKIKSFAKD-NCSYLTPTGHFVDTLLDETVVNKAIFYDFAFKRKARREAKFK-SEAIKNRQNK*FC |
| Parental | QKLRF |
| QKL.F | |
| Retrocopy | QKL*F |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 248 .22 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 150 .14 RPM |
| SRP021940_embryo | 0 .05 RPM | 317 .89 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 167 .86 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 223 .46 RPM |
| SRP021940_testis | 0 .00 RPM | 165 .17 RPM |