RetrogeneDB ID: | retro_mmul_573 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 1:201064077..201064296(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.4293 | ||
| Ensembl ID: | ENSMMUG00000016061 | ||
| Aliases: | None | ||
| Description: | signal recognition particle 14kDa (homologous Alu RNA binding protein) [Source:RefSeq peptide;Acc:NP_001252848] |
| Percent Identity: | 70.67 % |
| Parental protein coverage: | 54.74 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | GRTKPIPKKGTVEGFEPADNKCLLRATDGKKKISTVVSSKEVNKFQMAYSNLLRANMDGLKKRDKKNKTK |
| G..KPI.KK..V.GF...D..CLLR.TDGKKKIS..VSSKEVNKF.M.YSNLLR..MDGLKKRDKKN.T. | |
| Retrocopy | G*NKPILKKVSVVGFQYSD-RCLLRTTDGKKKISVMVSSKEVNKFWMTYSNLLRTKMDGLKKRDKKN-TS |
| Parental | KTKAA |
| ..KAA | |
| Retrocopy | NIKAA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 48 .63 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 70 .68 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 31 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 55 .29 RPM |
| SRP007412_kidney | 2 .93 RPM | 52 .35 RPM |
| SRP007412_liver | 0 .20 RPM | 34 .68 RPM |
| SRP007412_testis | 0 .00 RPM | 52 .70 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Callithrix jacchus | retro_cjac_1642 |