RetrogeneDB ID: | retro_rnor_2702 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 9:92746901..92747228(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSRNOG00000022614 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Srp14 | ||
| Ensembl ID: | ENSRNOG00000007512 | ||
| Aliases: | None | ||
| Description: | signal recognition particle 14 kDa protein [Source:RefSeq peptide;Acc:NP_001099967] |
| Percent Identity: | 89.91 % |
| Parental protein coverage: | 99.09 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MVLLESEQFLTELTRLFQKCRSSGSVFITLKKYDGRTKPIPRKSSVEGLEPAENKCLLRATDGKRKISTV |
| MVLL.SEQFLT.LTRLFQKC.SSGSVFITLKK.DG.TKPIP.KSSVEGLEPAENKCLLRATDGKRKISTV | |
| Retrocopy | MVLLKSEQFLTKLTRLFQKCWSSGSVFITLKKCDGCTKPIPQKSSVEGLEPAENKCLLRATDGKRKISTV |
| Parental | VSSKEVNKFQMAYSNLLRANMDGLKKRDKKNKSKKSKPA |
| .SSKE.NKF.MAYSNLLRA.M.GLKKRDKKNKSKKSKPA | |
| Retrocopy | GSSKEENKFEMAYSNLLRADMNGLKKRDKKNKSKKSKPA |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .14 RPM | 36 .52 RPM |
| SRP017611_kidney | 0 .07 RPM | 34 .05 RPM |
| SRP017611_liver | 0 .07 RPM | 23 .06 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000017231 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000029889 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000020912 | 3 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000012759 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000011870 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000009921 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000010531 | 5 retrocopies | |
| Macaca mulatta | ENSMMUG00000016061 | 4 retrocopies | |
| Monodelphis domestica | ENSMODG00000029204 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000008324 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000029070 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000008599 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000006342 | 3 retrocopies | |
| Rattus norvegicus | ENSRNOG00000007512 | 1 retrocopy |
retro_rnor_2702 ,
|
| Vicugna pacos | ENSVPAG00000010282 | 1 retrocopy |