RetrogeneDB ID: | retro_mluc_2284 | ||
Retrocopy location | Organism: | Microbat (Myotis lucifugus) | |
| Coordinates: | GL430178:61290..61524(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSMLUG00000028523 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSMLUG00000010531 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 59.49 % |
| Parental protein coverage: | 54.86 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | VLLESEQFLTELTRLFQKCRLSGSVFITLKKYDGRTKPIPRKGSVEGFEPSDNKCLLRATDGKKKISTVV |
| .LL.S.Q.L.EL.RLFQK..LS.SV...L....G.TK.I.RKGSVEGFEP.D.K..LRATDG.K.IS.V. | |
| Retrocopy | LLLGSAQSLSELIRLFQKRQLSASVLSALENHHGQTKAIARKGSVEGFEPPD-KSQLRATDGEKNISMVL |
| Parental | SSKEVNKFQ |
| SS.E...F. | |
| Retrocopy | SSNEASEFR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |