RetrogeneDB ID: | retro_itri_799 | ||
Retrocopy location | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
| Coordinates: | JH393325.1:235912..236121(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SRP14 | ||
| Ensembl ID: | ENSSTOG00000015627 | ||
| Aliases: | None | ||
| Description: | signal recognition particle 14kDa (homologous Alu RNA binding protein) [Source:HGNC Symbol;Acc:11299] |
| Percent Identity: | 59.72 % |
| Parental protein coverage: | 64.55 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | KYDGRTKPTPRKGSVEGVEPSDNKCLLRATDGKKKISTV-VSSKEVNKFQMAYSNLLRANMDGLKKRDKK |
| .Y...TKP...KGSVEG.EPSD.K......D.KK.I.T..VS.KEVNKFQMAYSNLLRA...GL.KR.K. | |
| Retrocopy | EYGSQTKPALSKGSVEGIEPSDGKSV-GSNDEKKRIITG<VSTKEVNKFQMAYSNLLRADTVGLEKRQKE |
| Parental | SK |
| .. | |
| Retrocopy | QE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000029889 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000020912 | 3 retrocopies | |
| Equus caballus | ENSECAG00000000319 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000011870 | 1 retrocopy | |
| Felis catus | ENSFCAG00000030207 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000009921 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000007637 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000016061 | 4 retrocopies | |
| Monodelphis domestica | ENSMODG00000029204 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000008324 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000029070 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000006342 | 3 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000002186 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000015627 | 9 retrocopies |
retro_itri_1334, retro_itri_1501, retro_itri_1633, retro_itri_382, retro_itri_432, retro_itri_707, retro_itri_710, retro_itri_799 , retro_itri_824,
|
| Tursiops truncatus | ENSTTRG00000000036 | 5 retrocopies | |
| Vicugna pacos | ENSVPAG00000010282 | 1 retrocopy |