RetrogeneDB ID: | retro_mmul_2198 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 7:153979088..153979334(+) | ||
| Located in intron of: | ENSMMUG00000000321 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSMMUG00000003867 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 89.02 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQHTKTTG |
| MQNPRQYKIPDWFLNRQK.VKDGKYSQVLANGLDNKL.EDLERLKKI.AHRGLRHFWGLRV..QHTKTTG | |
| Retrocopy | MQNPRQYKIPDWFLNRQKGVKDGKYSQVLANGLDNKLHEDLERLKKI*AHRGLRHFWGLRVQSQHTKTTG |
| Parental | RRGRTVGVSKKK |
| .R..TVG.SKKK | |
| Retrocopy | HRSHTVGDSKKK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .22 RPM | 6 .84 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 70 .84 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 6 .39 RPM |
| SRP007412_heart | 0 .06 RPM | 54 .76 RPM |
| SRP007412_kidney | 0 .00 RPM | 12 .21 RPM |
| SRP007412_liver | 0 .00 RPM | 64 .24 RPM |
| SRP007412_testis | 0 .04 RPM | 40 .45 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1371 |
| Pongo abelii | retro_pabe_1138 |