RetrogeneDB ID: | retro_fcat_1058 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | B4:96148043..96148420(-) | ||
| Located in intron of: | ENSFCAG00000014308 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS18 | ||
| Ensembl ID: | ENSFCAG00000004013 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S18 [Source:HGNC Symbol;Acc:10401] |
| Percent Identity: | 63.85 % |
| Parental protein coverage: | 84.87 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected: | 1 |
| Parental | RKIAFAITAIK-GVGRRYAHVVLRKADIDLTKRAGELTEDEVERVITIMQNPRQYKIPDWFLNRQKDVKD |
| ..IAFAIT....GVG.RYA.V.LRKADIDL..RAGELTEDE.E..I..M.NP.Q.KIPDWFLN.QKD... | |
| Retrocopy | QEIAFAITELR<GVG*RYAPVMLRKADIDLLRRAGELTEDEMECGISMM*NPHQHKIPDWFLNVQKD--- |
| Parental | GKYSQVLANGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK |
| ..YS.VLANGL.NKL.EDL..LKKI.AH..L.HF......GQH.KT.G....T.GVSKKK | |
| Retrocopy | ERYSRVLANGLYNKLHEDLDPLKKIWAHGVLCHF*EFHA*GQHAKTIGHHSHTMGVSKKK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 116 .49 RPM |
| SRP017611_kidney | 0 .00 RPM | 336 .48 RPM |
| SRP017611_liver | 0 .00 RPM | 218 .76 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000002918 | 1 retrocopy | |
| Ailuropoda melanoleuca | ENSAMEG00000001623 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000019675 | 4 retrocopies | |
| Felis catus | ENSFCAG00000004013 | 7 retrocopies |
retro_fcat_1058 , retro_fcat_1536, retro_fcat_166, retro_fcat_222, retro_fcat_313, retro_fcat_327, retro_fcat_430,
|
| Gorilla gorilla | ENSGGOG00000006571 | 5 retrocopies | |
| Loxodonta africana | ENSLAFG00000032173 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000007360 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000003867 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000002306 | 6 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000010546 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000025953 | 14 retrocopies | |
| Pan troglodytes | ENSPTRG00000018039 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000028505 | 4 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000006857 | 2 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000008658 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000002417 | 13 retrocopies |