RetrogeneDB ID: | retro_nleu_737 | ||
Retrocopy location | Organism: | Gibbon (Nomascus leucogenys) | |
| Coordinates: | GL397272.1:3850723..3851053(+) | ||
| Located in intron of: | ENSNLEG00000004495 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS18 | ||
| Ensembl ID: | ENSNLEG00000006840 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 86.36 % |
| Parental protein coverage: | 62.86 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | VVLRKADIDLTKRAGELTEDEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLE |
| .VLRKADIDLTK.AGELTEDE.ERV.TIMQNP.QYKIPDWFLNRQKDVKDGKYSQVLA.GLD.KL..D.E | |
| Retrocopy | MVLRKADIDLTKWAGELTEDEIERVMTIMQNPCQYKIPDWFLNRQKDVKDGKYSQVLASGLDKKLCADVE |
| Parental | RLKKIRAHRGLRHFWGLRVRGQHTKTTGRRGRTVGVSKKK |
| .LKKIRAHRGL.HFWGLRVRGQHTKTTG.RG.T.GVSKKK | |
| Retrocopy | *LKKIRAHRGLHHFWGLRVRGQHTKTTGHRGCTMGVSKKK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000000950 | 7 retrocopies | |
| Dipodomys ordii | ENSDORG00000013825 | 6 retrocopies | |
| Gorilla gorilla | ENSGGOG00000006571 | 5 retrocopies | |
| Loxodonta africana | ENSLAFG00000032173 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000003867 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000014210 | 4 retrocopies | |
| Mus musculus | ENSMUSG00000008668 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000006840 | 10 retrocopies |
retro_nleu_1074, retro_nleu_1161, retro_nleu_1176, retro_nleu_1466, retro_nleu_219, retro_nleu_2572, retro_nleu_2616, retro_nleu_525, retro_nleu_60, retro_nleu_737 ,
|
| Oryctolagus cuniculus | ENSOCUG00000010546 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000005854 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000025953 | 14 retrocopies | |
| Pan troglodytes | ENSPTRG00000018039 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000028505 | 4 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000006857 | 2 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000008658 | 1 retrocopy |