RetrogeneDB ID: | retro_mmul_1080 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 14:93771638..93771874(+) | ||
| Located in intron of: | ENSMMUG00000009394 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS16 | ||
| Ensembl ID: | ENSMMUG00000019370 | ||
| Aliases: | None | ||
| Description: | 40S ribosomal protein S16 [Source:RefSeq peptide;Acc:NP_001252707] |
| Percent Identity: | 70.0 % |
| Parental protein coverage: | 54.11 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | LLLGKERFAGVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVADPR |
| LLLGKE.FAGVDI.V.VKG.GHVA...AI.Q..SK.LVAYYQKYV.EASKK.IKDI.IQYD..LL..DP. | |
| Retrocopy | LLLGKEWFAGVDICVHVKGSGHVAETCAIQQYVSKSLVAYYQKYVNEASKKQIKDIFIQYDWILLIGDPF |
| Parental | R-CESKKFGG |
| ..C..KK.GG | |
| Retrocopy | A<CKFKKLGG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 21 .63 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 101 .07 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 23 .51 RPM |
| SRP007412_heart | 0 .00 RPM | 73 .96 RPM |
| SRP007412_kidney | 0 .12 RPM | 45 .54 RPM |
| SRP007412_liver | 0 .00 RPM | 143 .10 RPM |
| SRP007412_testis | 0 .00 RPM | 22 .65 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_813 |
| Pan troglodytes | retro_ptro_565 |
| Gorilla gorilla | retro_ggor_667 |
| Callithrix jacchus | retro_cjac_905 |