RetrogeneDB ID: | retro_pabe_1603 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 18:67042466..67042694(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | SNRPG | ||
| Ensembl ID: | ENSPPYG00000012324 | ||
| Aliases: | None | ||
| Description: | small nuclear ribonucleoprotein polypeptide G [Source:HGNC Symbol;Acc:11163] |
| Percent Identity: | 94.74 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIML |
| MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVI.ECVEM.TSG..NNIGMVVIRGNSIIML | |
| Retrocopy | MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIHECVEMTTSGK*NNIGMVVIRGNSIIML |
| Parental | EALERV |
| EALERV | |
| Retrocopy | EALERV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 4 .26 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 3 .16 RPM |
| SRP007412_heart | 0 .09 RPM | 6 .86 RPM |
| SRP007412_kidney | 0 .00 RPM | 11 .10 RPM |
| SRP007412_liver | 0 .03 RPM | 8 .17 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1943 |
| Pan troglodytes | retro_ptro_1297 |
| Gorilla gorilla | retro_ggor_1413 |