RetrogeneDB ID: | retro_mmur_1550 | ||
Retrocopylocation | Organism: | Mouse Lemur (Microcebus murinus) | |
| Coordinates: | scaffold_8144:16396..16615(+) | ||
| Located in intron of: | ENSMICG00000012641 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | SNRPG | ||
| Ensembl ID: | ENSMICG00000015369 | ||
| Aliases: | None | ||
| Description: | small nuclear ribonucleoprotein polypeptide G [Source:HGNC Symbol;Acc:11163] |
| Percent Identity: | 70.67 % |
| Parental protein coverage: | 94.74 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 2 |
| Parental | KAHPPELKKF-MDKKLSLKLN-GGR-HVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIM |
| .AHPP.LKK...D.KLSLKLN.GG..H.QGIL...DPFMNL.IDECVEM..S.Q.NNIGMVVI.GN..I. | |
| Retrocopy | QAHPPKLKKM>LDEKLSLKLNGGGD<HAQGILWSSDPFMNLMIDECVEMTASRQRNNIGMVVI*GNNVIL |
| Parental | LEALE |
| LEALE | |
| Retrocopy | LEALE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |