RetrogeneDB ID: | retro_tsyr_322 | ||
Retrocopylocation | Organism: | Tarsier (Tarsius syrichta) | |
| Coordinates: | GeneScaffold_8113:109473..109695(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | SNRPG | ||
| Ensembl ID: | ENSTSYG00000005729 | ||
| Aliases: | None | ||
| Description: | small nuclear ribonucleoprotein polypeptide G [Source:HGNC Symbol;Acc:11163] |
| Percent Identity: | 74.32 % |
| Parental protein coverage: | 97.37 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | MSKAHPPELKXXXXXXXXXKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIML |
| ..KAH.PELK.........K.NGGRHVQGIL.GFDPFMNLVIDECVEMATS.QQNNI.MVVI.GN.II.L | |
| Retrocopy | VNKAHLPELKKFMDKKL*LKINGGRHVQGILQGFDPFMNLVIDECVEMATSRQQNNIVMVVIWGNCIIIL |
| Parental | EALE |
| EALE | |
| Retrocopy | EALE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |