RetrogeneDB ID: | retro_ecab_197 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
| Coordinates: | 1:168465829..168466054(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | SNRPG | ||
| Ensembl ID: | ENSECAG00000019989 | ||
| Aliases: | None | ||
| Description: | small nuclear ribonucleoprotein polypeptide G [Source:HGNC Symbol;Acc:11163] |
| Percent Identity: | 82.67 % |
| Parental protein coverage: | 98.68 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 0 |
| Parental | MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIML |
| .SK.HPPELKKFMDKKLSLKLNGGR.V.G.L.GFDPFM.LVIDECVE.ATSGQ.NNIG.VV..GNSII.L | |
| Retrocopy | VSKVHPPELKKFMDKKLSLKLNGGRCV*GTLQGFDPFMDLVIDECVEIATSGQENNIGTVVM*GNSIITL |
| Parental | EALER |
| EALER | |
| Retrocopy | EALER |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 10 .98 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 13 .87 RPM |
| SRP021940_embryo | 0 .00 RPM | 36 .95 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 20 .54 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 17 .05 RPM |
| SRP021940_testis | 0 .00 RPM | 20 .14 RPM |