RetrogeneDB ID: | retro_pabe_1078 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 13_random:6362899..6363123(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | SNRPG | ||
| Ensembl ID: | ENSPPYG00000012324 | ||
| Aliases: | None | ||
| Description: | small nuclear ribonucleoprotein polypeptide G [Source:HGNC Symbol;Acc:11163] |
| Percent Identity: | 68.42 % |
| Parental protein coverage: | 98.68 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECV-EMATSGQQNNIGMVVIRGNSIIM |
| MSK..PPELKK.MDKKLSLKL..GRH.QGIL.GF.PFM...I.ECV.EMA..GQQ..IG.VVI.GNS.I. | |
| Retrocopy | MSKTNPPELKKIMDKKLSLKLTVGRHIQGILQGFGPFMHPEIGECV<EMAAGGQQSDIGLVVIQGNSFIV |
| Parental | LEALER |
| L.A.E. | |
| Retrocopy | LKAMEQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 4 .26 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 3 .16 RPM |
| SRP007412_heart | 0 .00 RPM | 6 .86 RPM |
| SRP007412_kidney | 0 .00 RPM | 11 .10 RPM |
| SRP007412_liver | 0 .00 RPM | 8 .17 RPM |