RetrogeneDB ID: | retro_mmul_1021 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 13:28455971..28456195(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MMU.18325 | ||
| Ensembl ID: | ENSMMUG00000007961 | ||
| Aliases: | None | ||
| Description: | small nuclear ribonucleoprotein G [Source:RefSeq peptide;Acc:NP_001180369] |
| Percent Identity: | 84.21 % |
| Parental protein coverage: | 98.68 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | SKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFD-PFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIML |
| SK.HP.ELK..MDKKLSLKLN.GRHVQGILRGF..PFMNLVIDECVEMATS.QQNNIGMVV..GNSII.L | |
| Retrocopy | SKVHPHELKNIMDKKLSLKLNSGRHVQGILRGFI<PFMNLVIDECVEMATSEQQNNIGMVVT*GNSIITL |
| Parental | EALERV |
| EALE.V | |
| Retrocopy | EALEQV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 1 .34 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 3 .57 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 1 .42 RPM |
| SRP007412_heart | 0 .00 RPM | 2 .47 RPM |
| SRP007412_kidney | 0 .00 RPM | 2 .35 RPM |
| SRP007412_liver | 0 .00 RPM | 1 .70 RPM |
| SRP007412_testis | 0 .00 RPM | 1 .32 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Callithrix jacchus | retro_cjac_1227 |