RetrogeneDB ID: | retro_cpor_843 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_3:687640..687845(-) | ||
| Located in intron of: | ENSCPOG00000015522 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | SNRPG | ||
| Ensembl ID: | ENSCPOG00000025022 | ||
| Aliases: | None | ||
| Description: | small nuclear ribonucleoprotein polypeptide G [Source:HGNC Symbol;Acc:11163] |
| Percent Identity: | 67.61 % |
| Parental protein coverage: | 90.79 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 2 |
| Parental | ELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVI-DECVEMATSGQ-QNNIGMVVIRGNSIIMLEALER |
| ELKKFMDKK.S...NGGR.VQGIL.GFDPFMN.VI..ECVEMAT..Q...N.G.VVI..NS....EAL.R | |
| Retrocopy | ELKKFMDKKFSPTINGGRKVQGILWGFDPFMNPVI<NECVEMATNRQ<MDNAGIVVIGRNSTTEPEALGR |
| Parental | V |
| V | |
| Retrocopy | V |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 7 .13 RPM |
| SRP017611_kidney | 0 .00 RPM | 15 .07 RPM |
| SRP017611_liver | 0 .00 RPM | 10 .71 RPM |
| SRP040447_lung | 0 .00 RPM | 14 .33 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 10 .28 RPM |