RetrogeneDB ID: | retro_ggor_1672 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 2a:28980276..28980488(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | ENSG00000143977 | ||
| Ensembl ID: | ENSGGOG00000022169 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 68.06 % |
| Parental protein coverage: | 78.02 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | PPEVKKFMDKKLSLKLNGGRHVQGILRGF-DPFMNLVIDECVEMATSGQQNNIGMVDNIPNKAVSPKFLK |
| P...KK.MDKKLSLKLNGGRHVQG.LRGF..PFMNLVIDECVEMATS.QQNNI.M.....N.......L. | |
| Retrocopy | PHKLKKIMDKKLSLKLNGGRHVQGMLRGF<YPFMNLVIDECVEMATSKQQNNIAMLVR*GNSIIMSEALE |
| Parental | KV |
| .V | |
| Retrocopy | QV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 1 .05 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 1 .22 RPM |
| SRP007412_heart | 0 .00 RPM | 1 .34 RPM |
| SRP007412_kidney | 0 .00 RPM | 3 .15 RPM |
| SRP007412_liver | 0 .00 RPM | 1 .45 RPM |
| SRP007412_testis | 0 .10 RPM | 3 .52 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2241 |
| Pan troglodytes | retro_ptro_1585 |