RetrogeneDB ID: | retro_tsyr_1727 | ||
Retrocopy location | Organism: | Tarsier (Tarsius syrichta) | |
| Coordinates: | scaffold_559870:188..429(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | LSM6 | ||
| Ensembl ID: | ENSTSYG00000012759 | ||
| Aliases: | None | ||
| Description: | LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) [Source:HGNC Symbol;Acc:17017] |
| Percent Identity: | 90.12 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | MSLRKQTP-SDF-KQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNN |
| MSLRKQTP.SDF.KQIIGRPVVVKLNSGVDYRG.LACLDGYM.IALEQTEEYVNGQLK.KYGDAFIRGNN | |
| Retrocopy | MSLRKQTP>SDFLKQIIGRPVVVKLNSGVDYRGILACLDGYMDIALEQTEEYVNGQLKKKYGDAFIRGNN |
| Parental | VLYISTQKRRM |
| VLYIS..KRR. | |
| Retrocopy | VLYISI*KRRI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000014060 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000002482 | 4 retrocopies | |
| Cavia porcellus | ENSCPOG00000015389 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000009322 | 5 retrocopies | |
| Homo sapiens | ENSG00000164167 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000001310 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000000571 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000026355 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000005524 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000000526 | 4 retrocopies | |
| Mus musculus | ENSMUSG00000031683 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000005584 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000026665 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000015105 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000016488 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000009036 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000006837 | 4 retrocopies | |
| Tarsius syrichta | ENSTSYG00000012759 | 4 retrocopies |