RetrogeneDB ID: | retro_mluc_1859 | ||
Retrocopy location | Organism: | Microbat (Myotis lucifugus) | |
| Coordinates: | GL429931:2446654..2446892(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | LSM6 | ||
| Ensembl ID: | ENSMLUG00000026355 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 68.29 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | MSLRKQTPS-DFLKQIIGRPVVVKLNSG-VDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGN |
| .SL.KQ.P..DFLKQII.RP..VKLNS...DY..VLA.LDGYMNI.LEQT..YVNGQ.K.K.GD..IRG. | |
| Retrocopy | ISLWKQSPE<DFLKQIIRRPGIVKLNSD<LDYGRVLAYLDGYMNISLEQTKDYVNGQPKSKCGDTRIRGD |
| Parental | NVLYISTQKRRM |
| .VL..STQKRRM | |
| Retrocopy | EVLHVSTQKRRM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000014060 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000015389 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000009322 | 5 retrocopies | |
| Homo sapiens | ENSG00000164167 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000001310 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000026355 | 1 retrocopy |
retro_mluc_1859 ,
|
| Monodelphis domestica | ENSMODG00000000526 | 4 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000005584 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000026665 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000009036 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000012759 | 4 retrocopies |