RetrogeneDB ID: | retro_tbel_2655 | ||
Retrocopy location | Organism: | Treeshrew (Tupaia belangeri) | |
| Coordinates: | scaffold_115518:262551..262861(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | GTF2A2 | ||
| Ensembl ID: | ENSTBEG00000001053 | ||
| Aliases: | None | ||
| Description: | general transcription factor IIA, 2, 12kDa [Source:HGNC Symbol;Acc:4647] |
| Percent Identity: | 62.26 % |
| Parental protein coverage: | 95.41 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected: | 2 |
| Parental | LYRNTTLGNSLQESLDELIQSQQITPQL-ALQVLLQFDKAIN-SALAQRVRNRVNFRGSLNTYRFCDNVW |
| ......LGNSLQ..L.E.I.S.Q..P...AL..LLQF.KAIN.SA.AQ..RNR..FRG.LNTYRFCDNV. | |
| Retrocopy | IIKKCILGNSLQGGLEEFI*S*QMIPNQ<AL*ALLQFHKAIN<SAPAQVARNRIHFRGFLNTYRFCDNV* |
| Parental | TFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTT |
| TFV.N.VE.R.V.E.IKV..VKIV..DGK.TG.NTT | |
| Retrocopy | TFVWNHVEVRVVAEVIKVNQVKIVVYDGKSTGFNTT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000010298 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000016665 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000000816 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000007867 | 3 retrocopies | |
| Homo sapiens | ENSG00000140307 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000018428 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000011636 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000007061 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000012841 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000007129 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000011062 | 2 retrocopies | |
| Sorex araneus | ENSSARG00000012228 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000004583 | 3 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000004010 | 3 retrocopies | |
| Tupaia belangeri | ENSTBEG00000001053 | 9 retrocopies |
retro_tbel_1162, retro_tbel_1207, retro_tbel_123, retro_tbel_1394, retro_tbel_1439, retro_tbel_257, retro_tbel_2655 , retro_tbel_2737, retro_tbel_513,
|
| Xenopus tropicalis | ENSXETG00000022002 | 1 retrocopy |