RetrogeneDB ID: | retro_tbel_1394 | ||
Retrocopy location | Organism: | Treeshrew (Tupaia belangeri) | |
| Coordinates: | GeneScaffold_4583:310094..310334(-) | ||
| Located in intron of: | ENSTBEG00000002518 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | GTF2A2 | ||
| Ensembl ID: | ENSTBEG00000001053 | ||
| Aliases: | None | ||
| Description: | general transcription factor IIA, 2, 12kDa [Source:HGNC Symbol;Acc:4647] |
| Percent Identity: | 87.5 % |
| Parental protein coverage: | 73.39 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | YQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINSALAQRVRNRVNFRGSLNTYRFCDNVW |
| YQLYRN..LGNSLQ.SLDELIQSQ.ITPQLALQVLLQFDKAI.SALAQRVRNRVNFRGSLNT.RFC.NVW | |
| Retrocopy | YQLYRNIALGNSLQGSLDELIQSQ*ITPQLALQVLLQFDKAIHSALAQRVRNRVNFRGSLNTNRFCNNVW |
| Parental | TFVLNDVEFR |
| T..LNDVE.R | |
| Retrocopy | TSILNDVELR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000010298 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000016665 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000000816 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000007867 | 3 retrocopies | |
| Homo sapiens | ENSG00000140307 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000018428 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000011636 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000007061 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000012841 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000007129 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000011062 | 2 retrocopies | |
| Sorex araneus | ENSSARG00000012228 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000004583 | 3 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000004010 | 3 retrocopies | |
| Tupaia belangeri | ENSTBEG00000001053 | 9 retrocopies |
retro_tbel_1162, retro_tbel_1207, retro_tbel_123, retro_tbel_1394 , retro_tbel_1439, retro_tbel_257, retro_tbel_2655, retro_tbel_2737, retro_tbel_513,
|
| Xenopus tropicalis | ENSXETG00000022002 | 1 retrocopy |