RetrogeneDB ID: | retro_mmul_2303 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 8:96942300..96942549(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.10042 | ||
| Ensembl ID: | ENSMMUG00000018428 | ||
| Aliases: | None | ||
| Description: | transcription initiation factor IIA subunit 2 [Source:RefSeq peptide;Acc:NP_001244983] |
| Percent Identity: | 96.39 % |
| Parental protein coverage: | 76.15 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINSALAQRVRNRVNFRGSLNTYRFCDN |
| MAYQLYRNTTL.NSLQESLDELIQSQQITPQLALQVLLQFDKAINSALAQRVRNRVNFRGSLNTYRFC.N | |
| Retrocopy | MAYQLYRNTTLRNSLQESLDELIQSQQITPQLALQVLLQFDKAINSALAQRVRNRVNFRGSLNTYRFCHN |
| Parental | VWTFVLNDVEFRE |
| VWTFVLNDVEFR. | |
| Retrocopy | VWTFVLNDVEFRD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 6 .72 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 3 .97 RPM |
| SRP007412_cerebellum | 0 .06 RPM | 6 .91 RPM |
| SRP007412_heart | 0 .06 RPM | 6 .07 RPM |
| SRP007412_kidney | 0 .00 RPM | 10 .80 RPM |
| SRP007412_liver | 0 .04 RPM | 2 .49 RPM |
| SRP007412_testis | 0 .23 RPM | 57 .22 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000010298 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000016665 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000000816 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000007867 | 3 retrocopies | |
| Homo sapiens | ENSG00000140307 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000018428 | 1 retrocopy |
retro_mmul_2303 ,
|
| Monodelphis domestica | ENSMODG00000011636 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000007061 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000012841 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000007129 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000011062 | 2 retrocopies | |
| Sorex araneus | ENSSARG00000012228 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000004583 | 3 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000004010 | 3 retrocopies | |
| Tupaia belangeri | ENSTBEG00000001053 | 9 retrocopies | |
| Xenopus tropicalis | ENSXETG00000022002 | 1 retrocopy |