RetrogeneDB ID: | retro_pvam_1326 | ||
Retrocopy location | Organism: | Megabat (Pteropus vampyrus) | |
| Coordinates: | scaffold_61923:1126..1367(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MRPS18C | ||
| Ensembl ID: | ENSPVAG00000006439 | ||
| Aliases: | None | ||
| Description: | mitochondrial ribosomal protein S18C [Source:HGNC Symbol;Acc:16633] |
| Percent Identity: | 69.05 % |
| Parental protein coverage: | 83.67 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | MAAMVDACIGLGRRKLIHFVTAAVCLPNPGTQAVLWRSCSQYKQVASNE-DLPVPMENPYKEPLKKCVLC |
| .AA.V..C.GLGR.KL.HF..AAVC.P.PGT..VLWRSCSQ.K.V.SNE.DL.VPMEN.YKE.L.K..LC | |
| Retrocopy | IAAVVAVCSGLGRKKLTHFIMAAVCFPDPGTHMVLWRSCSQSKRVTSNE<DLLVPMENLYKE-LLKMYLC |
| Parental | GKRV-DYKNVQLLS |
| .KRV..YKNVQLLS | |
| Retrocopy | RKRV<SYKNVQLLS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |