RetrogeneDB ID: | retro_ptro_1521 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 22:43273865..43274089(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MRPS18C | ||
| Ensembl ID: | ENSPTRG00000016233 | ||
| Aliases: | None | ||
| Description: | mitochondrial ribosomal protein S18C [Source:HGNC Symbol;Acc:16633] |
| Percent Identity: | 85.53 % |
| Parental protein coverage: | 52.82 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | CILCGKHVDYKNVQLLSQFVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMGFMPVTYKD-PAYLKDP |
| C.LCGK.VD.KNVQLLS.F.S.FTG.IYGR.I.GLCGKKQKEITKAIKRAQIMGFMPVTYKD..AYLKDP | |
| Retrocopy | CVLCGKRVDDKNVQLLSHFISAFTGGIYGRYIIGLCGKKQKEITKAIKRAQIMGFMPVTYKD<SAYLKDP |
| Parental | KVCNIR |
| KVCNIR | |
| Retrocopy | KVCNIR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 7 .35 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 6 .13 RPM |
| SRP007412_heart | 0 .00 RPM | 9 .91 RPM |
| SRP007412_kidney | 0 .03 RPM | 10 .46 RPM |
| SRP007412_liver | 0 .00 RPM | 9 .39 RPM |
| SRP007412_testis | 0 .63 RPM | 7 .38 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2597 |
| Macaca mulatta | retro_mmul_655 |