RetrogeneDB ID: | retro_dnov_1030 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_138025:3380..3626(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MRPS18C | ||
| Ensembl ID: | ENSDNOG00000018326 | ||
| Aliases: | None | ||
| Description: | mitochondrial ribosomal protein S18C [Source:HGNC Symbol;Acc:16633] |
| Percent Identity: | 81.71 % |
| Parental protein coverage: | 66.13 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | CLTASWTHTVLWRRGCSQHKQVTSHEDLPVPMENPFKEPLKKCILCGKCVDYKNVQLLSQFISPFTGCIY |
| CL..S..H.VLW.RGCSQ.K.VTSH.D.P.PMENPFKEPLKKCIL.GKCVDYKNV.LLSQFIS.FTGCIY | |
| Retrocopy | CLPHS*GHKVLWGRGCSQYKVVTSH*DRPIPMENPFKEPLKKCILFGKCVDYKNVHLLSQFISLFTGCIY |
| Parental | GRHITGLCGKKQ |
| GR.ITGLCGKKQ | |
| Retrocopy | GRYITGLCGKKQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 24 .70 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 17 .05 RPM |
| SRP012922_heart | 0 .00 RPM | 16 .01 RPM |
| SRP012922_kidney | 0 .00 RPM | 31 .49 RPM |
| SRP012922_liver | 0 .15 RPM | 17 .49 RPM |
| SRP012922_lung | 0 .31 RPM | 34 .21 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 11 .08 RPM |
| SRP012922_spleen | 0 .00 RPM | 32 .85 RPM |