RetrogeneDB ID: | retro_mmul_757 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 1099548049182:57785..58027(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | DBI | ||
| Ensembl ID: | ENSMMUG00000011126 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 60.98 % |
| Parental protein coverage: | 75.96 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | AAEEVKRLKTKPADDEML-FIYGRYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTTKED--AMKAYI |
| A....K..K.KPA.DEML...YGRY...T.G.INT.RP.MLDF.GKAKWD.WN.LKG..KED....KAY. | |
| Retrocopy | AVQDIKHFKMKPAYDEML<VLYGRYTPVTAGNINTQRPRMLDFKGKAKWDPWNALKGAAKEDPTKAKAYV |
| Parental | DKVEELKKKYGI |
| .KVEELKKK... | |
| Retrocopy | NKVEELKKKFRV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 17 .82 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 25 .62 RPM |
| SRP007412_cerebellum | 0 .06 RPM | 27 .96 RPM |
| SRP007412_heart | 0 .06 RPM | 49 .58 RPM |
| SRP007412_kidney | 0 .00 RPM | 93 .54 RPM |
| SRP007412_liver | 0 .00 RPM | 103 .12 RPM |
| SRP007412_testis | 0 .00 RPM | 73 .88 RPM |