RetrogeneDB ID: | retro_tbel_1617 | ||
Retrocopy location | Organism: | Treeshrew (Tupaia belangeri) | |
| Coordinates: | GeneScaffold_5258:294466..294712(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSTBEG00000015187 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | DBI | ||
| Ensembl ID: | ENSTBEG00000002067 | ||
| Aliases: | None | ||
| Description: | diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein) [Source:HGNC Symbol;Acc:2690] |
| Percent Identity: | 56.1 % |
| Parental protein coverage: | 79.61 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | EAEFEKAAEEVKHLKTKPGDSEMLFIYSHYKQATVGDINTERPGMLDLKGKAKWDAWNELKGTSKEDAMK |
| ..EFE.A....K.LK....D.E.L..YS.YKQAT.GD.N...P...D.K.KAKW.AWN..KG.SK.DAM. | |
| Retrocopy | QVEFELACAAIKQLKGPVSDQEKLLVYSFYKQATEGDCNIPAPPASDVKAKAKWEAWNVNKGMSKMDAMR |
| Parental | AYIDKVEELKKK |
| .Y..KVEELKKK | |
| Retrocopy | IYVSKVEELKKK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |