RetrogeneDB ID: | retro_cjac_954 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 12:4179077..4179291(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | DBI | ||
| Ensembl ID: | ENSCJAG00000021436 | ||
| Aliases: | None | ||
| Description: | diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein) [Source:HGNC Symbol;Acc:2690] |
| Percent Identity: | 63.51 % |
| Parental protein coverage: | 81.4 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | LKTKPGDDEMLFIYGHYKQATVGDINTERPGMLDFKGKA-KWDAWNELKGTTKEDAMK--AYI-NKVEEL |
| .KTKP.DDE.LF.Y..Y...TVGDI.TE.P.MLDFKGKA...D.WN.LKG..KEDAMK..AYI..K.EE. | |
| Retrocopy | VKTKPADDEVLFLYCRYRHTTVGDISTEQPRMLDFKGKA<QRDPWN*LKGAAKEDAMKARAYI<HKAEER |
| Parental | KKKY |
| KK.. | |
| Retrocopy | KKQF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 40 .67 RPM |
| SRP051959_heart | 0 .00 RPM | 47 .06 RPM |
| SRP051959_kidney | 0 .00 RPM | 45 .64 RPM |
| SRP051959_liver | 0 .00 RPM | 64 .18 RPM |
| SRP051959_lung | 0 .00 RPM | 18 .59 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 21 .05 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 23 .54 RPM |
| SRP051959_spleen | 0 .00 RPM | 30 .48 RPM |