RetrogeneDB ID: | retro_cpor_1139 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_5:41746352..41746683(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS7 | ||
| Ensembl ID: | ENSCPOG00000009795 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 68.1 % |
| Parental protein coverage: | 57.44 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 4 |
| Parental | KAIIIFVPVPQLKSFQKIQ-VRLVRELEKKFSGKHVVFIAQQRRILPKPTRKSRTK-NKQKRP-RSRTLT |
| ..II.FVP.PQLKSFQK...V.L..ELEK..SGK.VV..AQ.RRI.PKPT.KSRTK..KQKRP.RS.TLT | |
| Retrocopy | ETIITFVPGPQLKSFQKLW<VGLDQELEKDLSGKPVVSAAQ-RRIPPKPTWKSRTK>SKQKRP<RSCTLT |
| Parental | AVHDAILEDLVFPSEIVGKRIRVKLDGSRLIKVHLDKA-QQNNVEH |
| AVHDA.LEDLV.P.EI.GKR..VKL.G..L..VHL.KA.QQ.N.EH | |
| Retrocopy | AVHDAVLEDLVSPIEIAGKRTGVKLEGRGLTRVHLSKA<QQSNAEH |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 121 .99 RPM |
| SRP017611_kidney | 0 .00 RPM | 231 .57 RPM |
| SRP017611_liver | 0 .00 RPM | 142 .68 RPM |
| SRP040447_lung | 0 .00 RPM | 278 .94 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 318 .25 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000016224 | 5 retrocopies | |
| Canis familiaris | ENSCAFG00000003263 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000016462 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000009795 | 2 retrocopies |
retro_cpor_1139 , retro_cpor_773,
|
| Felis catus | ENSFCAG00000023243 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000023095 | 13 retrocopies | |
| Loxodonta africana | ENSLAFG00000015087 | 11 retrocopies | |
| Myotis lucifugus | ENSMLUG00000006121 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000061477 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000008507 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000028165 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000025872 | 12 retrocopies | |
| Pan troglodytes | ENSPTRG00000011615 | 3 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000002071 | 7 retrocopies | |
| Rattus norvegicus | ENSRNOG00000008551 | 2 retrocopies |