RetrogeneDB ID: | retro_btau_1430 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 5:66108867..66109095(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL37 | ||
| Ensembl ID: | ENSBTAG00000005142 | ||
| Aliases: | None | ||
| Description: | 60S ribosomal protein L37 [Source:UniProtKB/Swiss-Prot;Acc:P79244] |
| Percent Identity: | 82.89 % |
| Parental protein coverage: | 78.35 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | CGSKAYHLQKSTCGKCGYPAKRKRKYNWSAKAKRRNTTGTGRMRHLKIVYRRFRHGFREGTTPKPKRAAV |
| CGSKAYHLQK.T.GKCGYP.KRKRKYNWSAKAKR.NTTG.GRMRHLKI.Y.RFRHGF.E..TPKPK..AV | |
| Retrocopy | CGSKAYHLQK*THGKCGYPTKRKRKYNWSAKAKRQNTTGAGRMRHLKILYLRFRHGFHERATPKPKQVAV |
| Parental | AASSSS |
| A.SSSS | |
| Retrocopy | ATSSSS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 74 .98 RPM |
| ERP005899_muscle | 0 .05 RPM | 610 .98 RPM |
| SRP017611_brain | 0 .00 RPM | 61 .35 RPM |
| SRP017611_kidney | 0 .00 RPM | 98 .21 RPM |
| SRP017611_liver | 0 .00 RPM | 73 .62 RPM |
| SRP030211_testis | 0 .03 RPM | 64 .89 RPM |