RetrogeneDB ID: | retro_ecab_420 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 17:42465380..42465588(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL37 | ||
| Ensembl ID: | ENSECAG00000026905 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L37 [Source:HGNC Symbol;Acc:10347] |
| Percent Identity: | 59.72 % |
| Parental protein coverage: | 66.35 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 3 |
| Parental | YHLQKSTCGKCGYPAK-RKRKYNWSAKAKRRNTTGTGRMRHLK-IVYRRFRHGFREGTTPKP-KRAAVAA |
| YH..K.TCGKC..P.K..KRKY..S.KAK....TGTG..RH.K.I.Y.RFRH...EGTTPK..K.A.VA. | |
| Retrocopy | YHCEK*TCGKCI*PIK>AKRKYTSSGKAKL*KATGTGQLRHEK<IGYCRFRHELPEGTTPKS>KVAVVAC |
| Parental | SS |
| SS | |
| Retrocopy | SS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 780 .55 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 406 .16 RPM |
| SRP021940_embryo | 0 .00 RPM | 680 .72 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 383 .35 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 615 .72 RPM |
| SRP021940_testis | 0 .00 RPM | 435 .90 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1277 |
| Pan troglodytes | retro_ptro_873 |
| Gorilla gorilla | retro_ggor_1002 |
| Pongo abelii | retro_pabe_1058 |