RetrogeneDB ID: | retro_pvam_1478 | ||
Retrocopy location | Organism: | Megabat (Pteropus vampyrus) | |
| Coordinates: | scaffold_9571:27717..27922(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL37 | ||
| Ensembl ID: | ENSPVAG00000000921 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L37 [Source:HGNC Symbol;Acc:10347] |
| Percent Identity: | 54.17 % |
| Parental protein coverage: | 68.27 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | YHLQKSTCGKCGY-PAKRKRKYNWSAKAKRRNTTGTGRMRHLKIVYRRFRHGFREGTTPKPKRAAVAASS |
| YHL.KSTCGKC...P.K.K.K...SAKAK..N.T.TG.MR...IV..R....F..G.TPK...A.V.A.S | |
| Retrocopy | YHLEKSTCGKCYL>PSKCKEKV*PSAKAK*SNATSTGQMR---IVSHRSKYEFPKGITPKSEKAVVTAPS |
| Parental | SS |
| SS | |
| Retrocopy | SS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |