RetrogeneDB ID: | retro_mmus_2559 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 5:32838169..32838415(+) | ||
| Located in intron of: | ENSMUSG00000054280 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Rpl37 | ||
| Ensembl ID: | ENSMUSG00000041841 | ||
| Aliases: | Rpl37, 3110005M08Rik | ||
| Description: | ribosomal protein L37 [Source:MGI Symbol;Acc:MGI:1914531] |
| Percent Identity: | 85.37 % |
| Parental protein coverage: | 84.54 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | HTLCRRCGSKAYHLQKSTCGKCGYPAKRKRKYNWSAKAKRRNTTGTGRMRHLKIVYRRFRHGFREGTTPK |
| HTLC..C.SKAYHLQKSTCGKCGYPAK.K.KYNW..KAKRRNTTGTG.MRHLKIVY.RFRHGF.EGTTPK | |
| Retrocopy | HTLCCLCVSKAYHLQKSTCGKCGYPAKCKKKYNWRTKAKRRNTTGTGQMRHLKIVYCRFRHGFHEGTTPK |
| Parental | PKRAAVAASSSS |
| PKR.AV.ASSSS | |
| Retrocopy | PKRGAVVASSSS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .07 RPM | 65 .70 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 37 .21 RPM |
| SRP007412_heart | 0 .03 RPM | 58 .93 RPM |
| SRP007412_kidney | 0 .08 RPM | 45 .29 RPM |
| SRP007412_liver | 0 .14 RPM | 67 .59 RPM |
| SRP007412_testis | 0 .00 RPM | 51 .18 RPM |
| TSS No. | TSS Name | TSS expression level (Expr) in TPM range: | ||||
|---|---|---|---|---|---|---|
| no expression | 0 < Expr ≤ 1 | 1 < Expr ≤ 5 | 5 < Expr ≤ 10 | Expr > 10 | ||
| TSS #1 | TSS_113469 | 415 libraries | 411 libraries | 240 libraries | 6 libraries | 0 libraries |
