RetrogeneDB ID: | retro_ocun_879 | ||
Retrocopy location | Organism: | Rabbit (Oryctolagus cuniculus) | |
| Coordinates: | 16:73126787..73127006(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL37 | ||
| Ensembl ID: | ENSOCUG00000029674 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L37 [Source:HGNC Symbol;Acc:10347] |
| Percent Identity: | 68.49 % |
| Parental protein coverage: | 75.26 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | SKAYHLQKSTCGKCGYPAKRKRKYNWSAKAKRRNTTGTGRMRHLKIVYRRFRHGFREGTTPKPKRAAVAA |
| SKA.HLQK.TCGKC.Y....KR...WSAKA.RR..TG.G.MRHL.IVYRRF.HGFREG.TPKPK....AA | |
| Retrocopy | SKAHHLQKETCGKCAYITRCKRQRSWSAKARRRTITGSGGMRHLNIVYRRF*HGFREGATPKPKKETAAA |
| Parental | SSS |
| S.S | |
| Retrocopy | SGS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 77 .48 RPM |
| SRP017611_kidney | 0 .00 RPM | 140 .18 RPM |
| SRP017611_liver | 0 .00 RPM | 43 .39 RPM |