RetrogeneDB ID: | retro_sscr_167 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 1:105953385..105953629(-) | ||
| Located in intron of: | ENSSSCG00000004499 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | DBI | ||
| Ensembl ID: | ENSSSCG00000023435 | ||
| Aliases: | None | ||
| Description: | Sus scrofa diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein) (DBI), mRNA. [Source:RefSeq mRNA;Acc:NM_214119] |
| Percent Identity: | 71.26 % |
| Parental protein coverage: | 98.85 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 1 |
| Parental | MSQAEFEK-AAEEVKNLKTKPADDEMLFIYSHYKQATVGDINTERPGILDLKGKAKWDAWNGLKGTSKED |
| MSQ.E.EK.AAEEVKNLKTKPAD.EMLFI...YKQAT.GDI..ERPG.L.LKGKAKWD....LK.TSKED | |
| Retrocopy | MSQVESEK>AAEEVKNLKTKPAD-EMLFI*GYYKQATGGDISIERPGMLELKGKAKWDE---LKQTSKED |
| Parental | AMKAYINKVEELKKKYG |
| AM....NKV.E.KK..G | |
| Retrocopy | AMTV*VNKV-EVKKIHG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .66 RPM | 10 .22 RPM |
| SRP014902_testis | 0 .99 RPM | 29 .28 RPM |
| SRP018288_heart | 2 .04 RPM | 54 .88 RPM |
| SRP018288_kidney | 1 .28 RPM | 147 .56 RPM |
| SRP018288_liver | 1 .60 RPM | 177 .50 RPM |
| SRP018288_lung | 0 .41 RPM | 41 .95 RPM |
| SRP018856_adipose | 1 .04 RPM | 552 .16 RPM |
| SRP035408_brain | 0 .13 RPM | 379 .82 RPM |
| SRP035408_liver | 0 .23 RPM | 680 .73 RPM |