RetrogeneDB ID: | retro_cpor_576 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_2:28818302..28818511(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | DBI | ||
| Ensembl ID: | ENSCPOG00000000415 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 69.01 % |
| Parental protein coverage: | 82.14 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 2 |
| Parental | QPTDQEMLFIYSHYKQATVGDINTERPGMLD-LKGKAKW-DAWNQLKGTAKESAMKAYVDKVEELKNKYG |
| .PTDQE.LF..SHY.QA....INTE.PGMLD.LK.K....D..NQLKGT.KESAMKAYVDK.E.LKNKY. | |
| Retrocopy | KPTDQEVLFFSSHYEQAMMCHINTEMPGMLD>LKTKPRV>DKCNQLKGTSKESAMKAYVDKAEQLKNKYR |
| Parental | M |
| M | |
| Retrocopy | M |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 99 .56 RPM |
| SRP017611_kidney | 0 .00 RPM | 118 .72 RPM |
| SRP017611_liver | 0 .00 RPM | 92 .49 RPM |
| SRP040447_lung | 0 .00 RPM | 49 .18 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 51 .72 RPM |