RetrogeneDB ID: | retro_amel_993 | ||
Retrocopylocation | Organism: | Panda (Ailuropoda melanoleuca) | |
| Coordinates: | GL192805.1:1026381..1026589(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | DBI | ||
| Ensembl ID: | ENSAMEG00000008509 | ||
| Aliases: | None | ||
| Description: | diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein) [Source:HGNC Symbol;Acc:2690] |
| Percent Identity: | 73.24 % |
| Parental protein coverage: | 80.46 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | TKPADDEMLFIYSHYKQATVGDINTERPGLLDLKGKAKWDAWNQL-KGTSKEDAMKAYVNKVEELKKKYG |
| .KPADDE.LFIYS.YKQATVGD..TE.PGLLDL.GKAKWDAWNQL.KG.......KAY.NK.E.L.KKYG | |
| Retrocopy | SKPADDEILFIYSLYKQATVGDLKTEMPGLLDLRGKAKWDAWNQL>KGLPRK-MPKAYINKIEGL*KKYG |
| Parental | I |
| I | |
| Retrocopy | I |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |