RetrogeneDB ID: | retro_cfam_1452 | ||
Retrocopylocation | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 31:23064751..23064957(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | DBI | ||
| Ensembl ID: | ENSCAFG00000004895 | ||
| Aliases: | DBI, ACBP, EP | ||
| Description: | Canis lupus familiaris diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein) (DBI), mRNA. [Source:RefSeq mRNA;Acc:NM_001197047] |
| Percent Identity: | 72.86 % |
| Parental protein coverage: | 50.36 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | KPADDEMLYIYSHYKQATVGDINTERPGLLDLRGKA-KWDAWNQLKGTSKEDAMKAYVNKVEDLKKKYGI |
| KP.DDE.L.IYSHYKQATV.DI.TE.PGLL.L..KA..WDAWNQLK.TS.EDAM.A..NK.E.L.KKYGI | |
| Retrocopy | KPVDDETLFIYSHYKQATVDDIDTEQPGLLNLKDKA<QWDAWNQLKETSNEDAMEADINKAEVLYKKYGI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 333 .22 RPM |
| SRP017611_brain | 0 .00 RPM | 73 .28 RPM |
| SRP017611_kidney | 0 .00 RPM | 701 .51 RPM |
| SRP017611_liver | 0 .00 RPM | 196 .51 RPM |