RetrogeneDB ID: | retro_pvam_1121 | ||
Retrocopylocation | Organism: | Megabat (Pteropus vampyrus) | |
| Coordinates: | scaffold_3088:153031..153202(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | DBI | ||
| Ensembl ID: | ENSPVAG00000014349 | ||
| Aliases: | None | ||
| Description: | diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein) [Source:HGNC Symbol;Acc:2690] |
| Percent Identity: | 67.8 % |
| Parental protein coverage: | 58.42 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | EEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWNELKGTSKEGAVKAYINKVEEL |
| .E.LFI.S.YK..T.GDINT......D.K.K.KWDAWNELKGTSKE.A.KAYI.KVEEL | |
| Retrocopy | DEVLFICSYYKILTMGDINTDNDA--DHKCKVKWDAWNELKGTSKEDAMKAYIDKVEEL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |