RetrogeneDB ID: | retro_opri_125 | ||
Retrocopylocation | Organism: | Southern American pika (Ochotona princeps) | |
| Coordinates: | GeneScaffold_2535:43204..43450(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSOPRG00000002478 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | DBI | ||
| Ensembl ID: | ENSOPRG00000008363 | ||
| Aliases: | None | ||
| Description: | diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein) [Source:HGNC Symbol;Acc:2690] |
| Percent Identity: | 52.44 % |
| Parental protein coverage: | 78.85 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | TEAEFEKAAEEVKNLKAKPSDPEMLFIYSHYKQATVGDVNTDRPGMLDLKGKAKWDAWNELKGTSKESAM |
| ...EFE.A...VK.LK...SD.E.L..YS.YKQAT.GD.N...P.......KAKW.AWN..KG.SK..AM | |
| Retrocopy | SQVEFEMACAAVKQLKNPLSDQEKLLLYSLYKQATQGDCNLPVPPVSEVRAKAKWEAWNKIKGMSKMDAM |
| Parental | KAYVDKVEELKQ |
| ..YV.KV.ELK. | |
| Retrocopy | RNYVAKVDELKK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |