RetrogeneDB ID: | retro_btau_1718 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
| Coordinates: | GJ057383.1:619..856(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | DBI | ||
| Ensembl ID: | ENSBTAG00000009517 | ||
| Aliases: | DBI, ACBP, EP | ||
| Description: | Acyl-CoA-binding protein [Source:UniProtKB/Swiss-Prot;Acc:P07107] |
| Percent Identity: | 50.63 % |
| Parental protein coverage: | 90.8 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | QAEFDKAAEEVKHLKTKPADEEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWNELKGTSKEDAMK |
| Q..F..A....K.L...P.....L.IY..YKQAT.GD...ERPG..DF.G.AKWDAWN.LKG.....AM. | |
| Retrocopy | QTRFETAVANSKNLSERPDNPTLLKIYAFYKQATTGDVEGERPGFSDFVGRAKWDAWNGLKGKTADEAMQ |
| Parental | AYIDKVEEL |
| .YID..E.L | |
| Retrocopy | LYIDLIESL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .00 RPM | 224 .07 RPM |
| ERP005899_muscle | 0 .00 RPM | 139 .42 RPM |
| SRP017611_brain | 0 .00 RPM | 52 .94 RPM |
| SRP017611_kidney | 0 .00 RPM | 150 .31 RPM |
| SRP017611_liver | 0 .00 RPM | 67 .28 RPM |
| SRP030211_testis | 0 .00 RPM | 88 .45 RPM |