RetrogeneDB ID: | retro_rnor_2327 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 6:132323386..132323557(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Ndufa4 | ||
| Ensembl ID: | ENSRNOG00000005512 | ||
| Aliases: | None | ||
| Description: | NADH dehydrogenase [Source:RefSeq peptide;Acc:NP_001121156] |
| Percent Identity: | 55.93 % |
| Parental protein coverage: | 68.29 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 2 |
| Parental | MLRQILGQAKKH-PS-LIPLFVFIGAGGTGAALYVMRLALFNPDVSWDRKNNPE-PWNK |
| .L.Q.L.QAKKH.P....PL....G.....AALYVM.LAL.NPDVSW.RK.N.E..WN. | |
| Retrocopy | LLCQVLWQAKKH>PA*FLPLITVTGTEVPAAALYVMCLALLNPDVSWGRKSNSE<AWNE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 114 .32 RPM |
| SRP017611_kidney | 0 .00 RPM | 248 .01 RPM |
| SRP017611_liver | 0 .00 RPM | 104 .15 RPM |