RetrogeneDB ID: | retro_mmus_3219 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 8:78778007..78778174(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Ndufa4 | ||
| Ensembl ID: | ENSMUSG00000029632 | ||
| Aliases: | Ndufa4, MLRQ | ||
| Description: | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4 [Source:MGI Symbol;Acc:MGI:107686] |
| Percent Identity: | 85.96 % |
| Parental protein coverage: | 68.29 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | GTGAALYVMRLALFNPDVSWDRKNNPEPWNKLGPNEQYKFYSVNVDYSKLK-KEGPD |
| GTGAALYVMRL.LFN.DVSW.RKNNPEPWNKLGPN.Q.KFYSVN.DYSKLK..EGPD | |
| Retrocopy | GTGAALYVMRLPLFNLDVSWGRKNNPEPWNKLGPNKQ*KFYSVNEDYSKLK<NEGPD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .02 RPM | 138 .24 RPM |
| SRP007412_cerebellum | 0 .09 RPM | 158 .23 RPM |
| SRP007412_heart | 0 .03 RPM | 481 .55 RPM |
| SRP007412_kidney | 0 .06 RPM | 350 .73 RPM |
| SRP007412_liver | 0 .00 RPM | 195 .50 RPM |
| SRP007412_testis | 0 .00 RPM | 8 .87 RPM |