RetrogeneDB ID: | retro_cjac_3291 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 9:36176384..36176602(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | NDUFA4 | ||
| Ensembl ID: | ENSCJAG00000000748 | ||
| Aliases: | None | ||
| Description: | NADH dehydrogenase [Source:RefSeq peptide;Acc:NP_001240705] |
| Percent Identity: | 63.51 % |
| Parental protein coverage: | 89.02 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected | 1 |
| Parental | ILGQAKKHPSLIPLFVFIGAGGGGAALYLLRLALFN-PDVCWDKKNNPEPWNKLGPNDQYKFYSVNVDYS |
| IL.QAKKHPSLI.L..FIGAG...AALY.L.LALFN..DV....KNN..P..KLG.N..YKF.SVNV.YS | |
| Retrocopy | ILSQAKKHPSLILLLIFIGAGVPRAALYVLHLALFN<SDVSR*RKNNSKP*DKLGANN*YKFDSVNVGYS |
| Parental | KLKK |
| .L.. | |
| Retrocopy | NLAR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 26 .27 RPM |
| SRP051959_heart | 0 .00 RPM | 99 .24 RPM |
| SRP051959_kidney | 0 .00 RPM | 36 .14 RPM |
| SRP051959_liver | 0 .00 RPM | 37 .71 RPM |
| SRP051959_lung | 0 .00 RPM | 10 .28 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 13 .54 RPM |
| SRP051959_skeletal_muscle | 0 .02 RPM | 112 .79 RPM |
| SRP051959_spleen | 0 .00 RPM | 16 .47 RPM |