>retro_mmus_3620
ATGCTCCGCCAGATCATCGGGCAAGCCAAGAAGCATCCCAGCTTGATCTCTCTCTTCATATTTATCGGAGCCGGGGGTAC
TGGAGCAGCACTGTGTGTGATGCGCTTGGCATTGTTCAATCCAGATGTCACCTGGGACAGGAAGAACAACCCAGAGCCTT
GGAACAAGCTGGGTCCCAATGAACAATAGAAGTTCTACTCAGTCATTGTGGACTACAGCAAACTGAAGAAAGAAGGCCCA
GACTTC
ORF - retro_mmus_3620 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: |
91.46 % |
| Parental protein coverage: |
100. % |
| Number of stop codons detected: |
1 |
| Number of frameshifts detected |
0 |
Retrocopy - Parental Gene Alignment:
| Parental | MLRQILGQAKKHPSLIPLFVFIGAGGTGAALYVMRLALFNPDVSWDRKNNPEPWNKLGPNEQYKFYSVNV |
| | MLRQI.GQAKKHPSLI.LF.FIGAGGTGAAL.VMRLALFNPDV.WDRKNNPEPWNKLGPNEQ.KFYSV.V |
| Retrocopy | MLRQIIGQAKKHPSLISLFIFIGAGGTGAALCVMRLALFNPDVTWDRKNNPEPWNKLGPNEQ*KFYSVIV |
|
| Parental | DYSKLKKEGPDF |
| | DYSKLKKEGPDF |
| Retrocopy | DYSKLKKEGPDF |
|
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)
Expression validation based on RNA-Seq data:
| Library |
Retrocopy expression |
Parental gene expression |
| SRP007412_brain |
0 .00 RPM |
138 .24 RPM |
| SRP007412_cerebellum |
0 .00 RPM |
158 .23 RPM |
| SRP007412_heart |
0 .00 RPM |
481 .55 RPM |
| SRP007412_kidney |
0 .04 RPM |
350 .73 RPM |
| SRP007412_liver |
0 .00 RPM |
195 .50 RPM |
| SRP007412_testis |
0 .00 RPM |
8 .87 RPM |
RNA Polymerase II actvity near the 5' end of retro_mmus_3620 was not detected
No EST(s) were mapped for retro_mmus_3620 retrocopy.
No TSS is located nearby retro_mmus_3620 retrocopy 5' end.
retro_mmus_3620 was not experimentally validated.
Retrocopy orthology:
Retrocopy retro_mmus_3620 has 0 orthologous retrocopies within eutheria group .
Parental genes homology:
Parental genes homology involve
22 parental genes, and
123 retrocopies.
| Species |
Parental gene accession |
Retrocopies number |
|
| Ailuropoda melanoleuca | ENSAMEG00000002493 | 10 retrocopies |
retro_amel_1356, retro_amel_1633, retro_amel_18, retro_amel_1800, retro_amel_1866, retro_amel_533, retro_amel_608, retro_amel_638, retro_amel_845, retro_amel_955,
|
| Bos taurus | ENSBTAG00000011145 | 7 retrocopies |
|
| Callithrix jacchus | ENSCJAG00000000748 | 3 retrocopies |
|
| Equus caballus | ENSECAG00000026987 | 1 retrocopy |
|
| Felis catus | ENSFCAG00000024790 | 4 retrocopies |
|
| Gorilla gorilla | ENSGGOG00000001437 | 3 retrocopies |
|
| Myotis lucifugus | ENSMLUG00000006470 | 6 retrocopies |
|
| Macaca mulatta | ENSMMUG00000020894 | 2 retrocopies |
|
| Monodelphis domestica | ENSMODG00000014107 | 2 retrocopies |
|
| Mustela putorius furo | ENSMPUG00000014152 | 8 retrocopies |
|
| Mus musculus | ENSMUSG00000029632 | 4 retrocopies |
|
| Oryctolagus cuniculus | ENSOCUG00000029372 | 1 retrocopy |
|
| Otolemur garnettii | ENSOGAG00000000358 | 17 retrocopies |
retro_ogar_1023, retro_ogar_1026, retro_ogar_1319, retro_ogar_1403, retro_ogar_1566, retro_ogar_1960, retro_ogar_1976, retro_ogar_2050, retro_ogar_2350, retro_ogar_2528, retro_ogar_3023, retro_ogar_3413, retro_ogar_3434, retro_ogar_3457, retro_ogar_694, retro_ogar_731, retro_ogar_997,
|
| Ochotona princeps | ENSOPRG00000014186 | 3 retrocopies |
|
| Pongo abelii | ENSPPYG00000017780 | 5 retrocopies |
|
| Pteropus vampyrus | ENSPVAG00000006660 | 5 retrocopies |
|
| Rattus norvegicus | ENSRNOG00000005512 | 3 retrocopies |
|
| Sorex araneus | ENSSARG00000011125 | 8 retrocopies |
|
| Sus scrofa | ENSSSCG00000024313 | 6 retrocopies |
|
| Tupaia belangeri | ENSTBEG00000016629 | 16 retrocopies |
retro_tbel_1049, retro_tbel_1848, retro_tbel_2008, retro_tbel_2058, retro_tbel_2194, retro_tbel_2274, retro_tbel_2423, retro_tbel_2761, retro_tbel_3262, retro_tbel_4255, retro_tbel_4309, retro_tbel_436, retro_tbel_4380, retro_tbel_4426, retro_tbel_4719, retro_tbel_815,
|
| Tursiops truncatus | ENSTTRG00000013045 | 8 retrocopies |
|